General Information

  • ID:  hor004526
  • Uniprot ID:  P01168
  • Protein name:  Neuronostatin
  • Gene name:  SST
  • Organism:  Sus scrofa (Pig)
  • Family:  Somatostatin family
  • Source:  Animal
  • Expression:  [Neuronostatin]: Expressed in the pancreas and the spleen (at protein level).
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Sus (genus), Suidae (family), Suina (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0048018 receptor ligand activity
  • GO BP:  GO:0030334 regulation of cell migration; GO:0038170 somatostatin signaling pathway; GO:0099072 regulation of postsynaptic membrane neurotransmitter receptor levels
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0098982 GABA-ergic synapse

Sequence Information

  • Sequence:  LRQFLQKSLAAAA
  • Length:  13(31-43)
  • Propeptide:  MLSCRLQCALAALSIVLALGGVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEPNQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC
  • Signal peptide:  MLSCRLQCALAALSIVLALGGVTG
  • Modification:  T13 Alanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May enhance low-glucose-induced glucagon release by pancreatic alpha cells. This effect may be mediated by binding to GPR107 and PKA activation. May regulate cardiac contractile function. May compromise cardiomyocyte viability. In the central nervous syst
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  SSTR2, SSTR5
  • Target Unid:  P34994, A0A286ZRE5
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01168-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004526_AF2.pdbhor004526_ESM.pdb

Physical Information

Mass: 163093 Formula: C64H109N19O17
Absent amino acids: CDEGHIMNPTVWY Common amino acids: A
pI: 11.65 Basic residues: 2
Polar residues: 1 Hydrophobic residues: 8
Hydrophobicity: 40 Boman Index: -997
Half-Life: 5.5 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 120.77
Instability Index: 5813.85 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  18753129
  • Title:  Neuronostatin Encoded by the Somatostatin Gene Regulates Neuronal, Cardiovascular, and Metabolic Functions